PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B01827.1.p
Common NameEUGRSUZ_B01827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 452aa    MW: 49945.2 Da    PI: 8.4913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B01827.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-1767114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.B01827.1.p  67 KGLWSPEEDEKLLNYIAKFGLGCWSSVPKLAGLQRCGKSCRLRWINYL 114
                       678*******************************************97 PP

2Myb_DNA-binding45.41.9e-14120162145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       rg+++++E+ l++++++ lG++ W+ Ia++++ gRt++++k+ w+
  Eucgr.B01827.1.p 120 RGAFSQQEESLIIELHAVLGNR-WSQIAAHLP-GRTDNEIKNLWN 162
                       89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-2659117IPR009057Homeodomain-like
PROSITE profilePS5129424.77162118IPR017930Myb domain
SuperFamilySSF466891.72E-2965161IPR009057Homeodomain-like
SMARTSM007173.4E-1366116IPR001005SANT/Myb domain
PfamPF002491.3E-1567114IPR001005SANT/Myb domain
CDDcd001674.56E-1270114No hitNo description
Gene3DG3DSA:1.10.10.601.1E-24118169IPR009057Homeodomain-like
PROSITE profilePS5129419.206119169IPR017930Myb domain
SMARTSM007175.9E-12119167IPR001005SANT/Myb domain
PfamPF002493.3E-13120162IPR001005SANT/Myb domain
CDDcd001671.24E-9122162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MLQASADIIS LRHSQFISAT SITVSTYNIP FTHSPFHLPH RLERFFRKSR HFCMGRHSCC  60
HKQKLRKGLW SPEEDEKLLN YIAKFGLGCW SSVPKLAGLQ RCGKSCRLRW INYLRPDLKR  120
GAFSQQEESL IIELHAVLGN RWSQIAAHLP GRTDNEIKNL WNSGLKKKLR KNGIDPNTHK  180
PLSLFENSDQ QKFHAIYEAS VASTKPNLSQ ASSTSSSQNL RVTPSPELSF KRPGIVDDGS  240
FITCFPPAGM VGELCFQHLK CSGTMGLLAS SDTALHHDWN WSSSDISPTQ VHSAPKPNRP  300
SDSYYCNIDG GNSSHWSGIA PLQNVHTFEN SPNSYISADC GRVDKETETH PSVFDAEVAK  360
WFEYLHHTPF VFNLSPSGAS QLEHSDVTPS AGTCSVTGGG LVSNCPHDQI LQASPGSDMY  420
GKTLQVIAVS SGQNSPSSLE PVKNKFQDKK V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29651695108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B01827.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010042485.10.0PREDICTED: transcription factor MYB86 isoform X1
SwissprotQ8LPH63e-75MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A059D4920.0A0A059D492_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s00340.12e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-81myb domain protein 86